CYBRD1 Recombinant monoclonal antibody, PBS Only

CYBRD1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86245-1-PBS
Clone No.250771A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Cytochrome b reductase 1, DCYTB, Duodenal cytochrome b, EC:7.2.1.3, Ferric chelate reductase 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86245-1-PBS targets CYBRD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24968

Product name: Recombinant human CYBRD1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 148-286 aa of BC065290

Sequence: PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM

Predict reactive species
Full Name cytochrome b reductase 1
Observed Molecular Weight 25-31 kDa
GenBank Accession NumberBC065290
Gene Symbol CYBRD1
Gene ID (NCBI) 79901
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ53TN4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CYBRD1, also known as Cytochrome b Reductase 1, is a gene encoding a key enzyme involved in iron metabolism. It functions primarily in duodenal enterocytes, where it reduces dietary ferric iron (Fe³⁺) to the more soluble ferrous form (Fe²⁺) at the brush border membrane. This reduction step is crucial for the subsequent uptake of iron into the body via the divalent metal transporter 1 (DMT1). CYBRD1's activity is therefore essential for maintaining systemic iron homeostasis, and its expression is regulated by body iron stores and hypoxia. Dysregulation of this gene has been implicated in disorders of iron overload, such as hereditary hemochromatosis, highlighting its significant role in human iron physiology.

Loading...
||
New chat

Able

正在加载,请稍候...