CYBRD1 Recombinant monoclonal antibody

CYBRD1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86245-1-RR
Clone No.250771A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Cytochrome b reductase 1, DCYTB, Duodenal cytochrome b, EC:7.2.1.3, Ferric chelate reductase 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inT-47D cells, mouse colon tissue, rat colon tissue, COLO 320 cells, SW480 cells, HCT 116 cells, NCI-H1299 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86245-1-RR targets CYBRD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24968

Product name: Recombinant human CYBRD1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 148-286 aa of BC065290

Sequence: PLSLRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNNEVAARKRNLALDEAGQRSTM

Predict reactive species
Full Name cytochrome b reductase 1
Observed Molecular Weight 25-31 kDa
GenBank Accession NumberBC065290
Gene Symbol CYBRD1
Gene ID (NCBI) 79901
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ53TN4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYBRD1, also known as Cytochrome b Reductase 1, is a gene encoding a key enzyme involved in iron metabolism. It functions primarily in duodenal enterocytes, where it reduces dietary ferric iron (Fe³⁺) to the more soluble ferrous form (Fe²⁺) at the brush border membrane. This reduction step is crucial for the subsequent uptake of iron into the body via the divalent metal transporter 1 (DMT1). CYBRD1's activity is therefore essential for maintaining systemic iron homeostasis, and its expression is regulated by body iron stores and hypoxia. Dysregulation of this gene has been implicated in disorders of iron overload, such as hereditary hemochromatosis, highlighting its significant role in human iron physiology.

Protocols

Product Specific Protocols
WB protocol for CYBRD1 antibody 86245-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...