Product Information
67421-3-PBS targets CYP21A2 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26292 Product name: Recombinant human CYP21A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 103-202 aa of NM_000500 Sequence: MNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWS Predict reactive species |
| Full Name | cytochrome P450, family 21, subfamily A, polypeptide 2 |
| Calculated Molecular Weight | 56 kDa |
| GenBank Accession Number | NM_000500 |
| Gene Symbol | CYP21A2 |
| Gene ID (NCBI) | 1589 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08686 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

