Calpastatin Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of HeLa using 67107-1-Ig (same clone as 67107-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (CAST antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67107-1-Ig (same clone as 67107-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (Calpastatin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67107-1-Ig (same clone as 67107-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (Calpastatin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67107-1-Ig (same clone as 67107-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (Calpastatin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67107-1-Ig (same clone as 67107-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (Calpastatin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 67107-1-Ig (same clone as 67107-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67107-1-Ig (Calpastatin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67107-1-Ig (same clone as 67107-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Calpastatin antibody (67107-1-Ig, Clone: 1G12A2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67107-1-Ig (same clone as 67107-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug Calpastatin Monoclonal antibody (67107-1-Ig, Clone:1G12A2) and CoraLite488-conjugated Donkey Anti-Mouse IgG(H+L)( SA00013-5)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 67107-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50744-2

  Cytometric bead array standard curve of MP50744-2, CAST Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67107-1-PBS. Detection antibody: 67107-3-PBS. Standard:Ag28669. Range: 0.098-100 ng/mL.

• 

  Cytometric bead array standard curve of MP50744-3

  Cytometric bead array standard curve of MP50744-3, CAST Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67107-1-PBS. Detection antibody: 67107-4-PBS. Standard:Ag28669. Range: 0.098-100 ng/mL.

Calpastatin Monoclonal Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 67107-1-PBS

Clone No.1G12A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

CAST, 1G12A2, Calpain inhibitor, Sperm BS-17 component

---

Product Information

67107-1-PBS targets Calpastatin as part of a matched antibody pair:

MP50744-2: 67107-1-PBS capture and 67107-3-PBS detection (validated in Cytometric bead array)

MP50744-3: 67107-1-PBS capture and 67107-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28669

  Product name: Recombinant human CAST protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC013579

  Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK

• Full Name: calpastatin
• Calculated Molecular Weight: 667 aa, 72 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC013579
• Gene Symbol: Calpastatin
• Gene ID (NCBI): 831
• RRID: AB_2882411
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P20810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calpastatin (CAST) is an endogenous protein that specifically inhibits the activity of calpains, a family of calcium-dependent proteases involved in numerous cellular processes. The CAST gene encodes calpastatin, which contains multiple calpain-inhibiting domains that bind to the active site of calpain, preventing it from performing its functions. Calpastatin is found in the cytosol and plays a key role in regulating intracellular proteolysis, with malfunctions in the calpain-calpastatin system linked to various diseases, including autoimmune disorders and neurodegenerative conditions