Calpastatin Monoclonal antibody, PBS Only (Capture)

Calpastatin Monoclonal Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 67107-1-PBS
Clone No.1G12A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

CAST, 1G12A2, Calpain inhibitor, Sperm BS-17 component

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67107-1-PBS targets Calpastatin as part of a matched antibody pair:

MP50744-2: 67107-1-PBS capture and 67107-3-PBS detection (validated in Cytometric bead array)

MP50744-3: 67107-1-PBS capture and 67107-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28669

Product name: Recombinant human CAST protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC013579

Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK

Predict reactive species
Full Name calpastatin
Calculated Molecular Weight 667 aa, 72 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC013579
Gene Symbol Calpastatin
Gene ID (NCBI) 831
RRIDAB_2882411
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP20810
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Calpastatin (CAST) is an endogenous protein that specifically inhibits the activity of calpains, a family of calcium-dependent proteases involved in numerous cellular processes. The CAST gene encodes calpastatin, which contains multiple calpain-inhibiting domains that bind to the active site of calpain, preventing it from performing its functions. Calpastatin is found in the cytosol and plays a key role in regulating intracellular proteolysis, with malfunctions in the calpain-calpastatin system linked to various diseases, including autoimmune disorders and neurodegenerative conditions

Loading...
||
New chat

Able

正在加载,请稍候...