Tested Applications
| Positive WB detected in | mouse stomach tissue |
| Positive IHC detected in | human colon tissue, human breast hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24855-1-AP targets Calponin 1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
| Full Name | calponin 1, basic, smooth muscle |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC022015 |
| Gene Symbol | Calponin |
| Gene ID (NCBI) | 1264 |
| RRID | AB_2879758 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51911 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Calponin 1 antibody 24855-1-AP | Download protocol |
| IHC protocol for Calponin 1 antibody 24855-1-AP | Download protocol |
| WB protocol for Calponin 1 antibody 24855-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Calponin 1 Polyclonal antibody (Cat# 24855-1-AP) has 18 total citations published across 16 journals, including Nature Communications, Bioactive Materials, Acta Pharmaceutica Sinica B, Advanced Healthcare Materials, Phytomedicine, Journal of Molecular and Cellular Cardiology, Scientific Reports, and FASEB Journal. The research fields primarily involve vascular smooth muscle cell biology, aortic aneurysm, atherosclerosis, hypertension, and cardiovascular disease mechanisms.
| Species | Application | Title |
|---|---|---|
Bioact Mater A TEMPOL and rapamycin loaded nanofiber-covered stent favors endothelialization and mitigates neointimal hyperplasia and local inflammation. | ||
Nat Commun PTPN14 aggravates neointimal hyperplasia via boosting PDGFRβ signaling in smooth muscle cells | ||
Nat Commun PDK4 drives abdominal aortic aneurysm by promoting smooth muscle cell metabolic reprogramming and NLRP3-mediated pyroptosis. | ||
Acta Pharm Sin B Cytoplasmic and nuclear NFATc3 cooperatively contributes to vascular smooth muscle cell dysfunction and drives aortic aneurysm and dissection | ||
Phytomedicine Lutein protects senescent ciliary muscle against oxidative stress through the Keap1/Nrf2/ARE pathway | ||
Adv Healthc Mater Enhanced Vascular Smooth Muscle Cell and Extracellular Matrix Repair Using a Metal-Organic Framework-Based Co-Delivery System for Abdominal Aortic Aneurysm Therapy |
