Tested Applications
Positive WB detected in | mouse stomach tissue |
Positive IHC detected in | human colon tissue, human breast hyperplasia tissue, human heart tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse heart tissue |
Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 14 publications below |
Product Information
24855-1-AP targets Calponin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
Full Name | calponin 1, basic, smooth muscle |
Calculated Molecular Weight | 33 kDa |
Observed Molecular Weight | 34 kDa |
GenBank Accession Number | BC022015 |
Gene Symbol | Calponin |
Gene ID (NCBI) | 1264 |
RRID | AB_2879758 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P51911 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Calponin antibody 24855-1-AP | Download protocol |
IHC protocol for Calponin antibody 24855-1-AP | Download protocol |
IF protocol for Calponin antibody 24855-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Bioact Mater A TEMPOL and rapamycin loaded nanofiber-covered stent favors endothelialization and mitigates neointimal hyperplasia and local inflammation. | ||
Mol Ther Nucleic Acids Long Non-coding RNA PEBP1P2 Suppresses Proliferative VSMCs Phenotypic Switching and Proliferation in Atherosclerosis. | ||
Sci Rep Nicotine facilitates VSMC dysfunction through a miR-200b/RhoGDIA/cytoskeleton module. | ||
Front Mol Biosci Integrated Strategies of Diverse Feature Selection Methods Identify Aging-Based Reliable Gene Signatures for Ischemic Cardiomyopathy. | ||
J Mol Cell Cardiol miR-564: A potential regulator of vascular smooth muscle cells and therapeutic target for aortic dissection. |