Calponin Recombinant monoclonal antibody

• 

  WB analysis using 86977-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86977-4-RR (Calponin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human appendix using 86977-4-RR

  Immunohistochemical analysis of paraffin-embedded human appendix tissue slide using 86977-4-RR (Calponin antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendix using 86977-4-RR

  Immunohistochemical analysis of paraffin-embedded human appendix tissue slide using 86977-4-RR (Calponin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 86977-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Calponin antibody (86977-4-RR, Clone: 252040C7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 86977-4-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Calponin antibody (86977-4-RR, Clone: 252040C7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 86977-4-RR

  Biolayer interferometry (BLl) kinetic assays of 86977-4-RR against Human Calponin were performed. The affinity constant is 1.34 nM.

Calponin Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 86977-4-RR

Clone No.252040C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

CNN1, Basic calponin, Calponin 1, Calponin-1, CNN 1

---

Tested Applications

• Positive WB detected in: mouse colon tissue, mouse bladder tissue, rat bladder tissue
• Positive IHC detected in: human appendix tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86977-4-RR targets Calponin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21384

  Product name: Recombinant human Calponin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 225-265 aa of BC022015

  Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR

• Full Name: calponin 1, basic, smooth muscle
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC022015
• Gene Symbol: Calponin
• Gene ID (NCBI): 1264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51911
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation.