Tested Applications
| Positive WB detected in | mouse colon tissue, mouse bladder tissue, rat bladder tissue |
| Positive IHC detected in | human appendix tissue, human colon tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86977-4-RR targets Calponin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
| Full Name | calponin 1, basic, smooth muscle |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC022015 |
| Gene Symbol | Calponin |
| Gene ID (NCBI) | 1264 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51911 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Calponin antibody 86977-4-RR | Download protocol |
| IHC protocol for Calponin antibody 86977-4-RR | Download protocol |
| WB protocol for Calponin antibody 86977-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |















