Cannabinoid receptor 1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of fetal human brain using 82787-2-RR (same clone as 82787-2-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 82787-2-RR (CNR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82787-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82787-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82787-2-RR against Human Cannabinoid receptor 1 were performed. The affinity constant is 22.3 nM.

Cannabinoid receptor 1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82787-2-PBS

Clone No.250285C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CNR1, CANN6, cannabinoid receptor 1 (brain), CB R, CB1

---

Product Information

82787-2-PBS targets Cannabinoid receptor 1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12625

  Product name: Recombinant human CNR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-121 aa of BC074812

  Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV

• Full Name: cannabinoid receptor 1 (brain)
• Calculated Molecular Weight: 472 aa, 53 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC074812
• Gene Symbol: Cannabinoid receptor 1
• Gene ID (NCBI): 1268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21554
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.