Product Information
82787-2-PBS targets Cannabinoid receptor 1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag12625 Product name: Recombinant human CNR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species |
| Full Name | cannabinoid receptor 1 (brain) |
| Calculated Molecular Weight | 472 aa, 53 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC074812 |
| Gene Symbol | Cannabinoid receptor 1 |
| Gene ID (NCBI) | 1268 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P21554 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.



