Carbonic Anhydrase 6/CA6 Recombinant monoclonal antibody

Carbonic Anhydrase 6/CA6 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85940-3-RR
Clone No.250412A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

CA6, CA VI, Carbonate dehydratase VI, Carbonic anhydrase 6, CA-VI

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman saliva

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85940-3-RR targets Carbonic Anhydrase 6/CA6 in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2963

Product name: Recombinant Human Carbonic Anhydrase 6/CA6 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 18-308 aa of NM_001215.3

Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

Predict reactive species
Full Name carbonic anhydrase VI
Calculated Molecular Weight35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberNM_001215.3
Gene Symbol CA6
Gene ID (NCBI) 765
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23280-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA6 (Carbonic anhydrase VI ) is a member of CA family proteins that play a central role in pH regulation and electrolyte balance. CA6 is also known as gustin, is a zinc-containing secreted protein which catalyzes the hydration of carbon hydroxide in saliva. CA6 is specifically expressed in the salivary gland of a number of mammalian species (PMID:28423504). The amino acid sequences are highly conserved across the species. And it was reported that decreasing of CA6 protein was associated with loss of taste and pathological morphology of taste buds (PMID: 9784398).

Protocols

Product Specific Protocols
WB protocol for Carbonic Anhydrase 6/CA6 antibody 85940-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...