Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, LNCaP cells, PC-3 cells, MCF-7 cells, mouse liver tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 70 publications below |
| IHC | See 4 publications below |
| IP | See 1 publications below |
Product Information
27155-1-AP targets Caspase 7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25904 Product name: Recombinant human Caspase 7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC015799 Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC Predict reactive species |
| Full Name | caspase 7, apoptosis-related cysteine peptidase |
| Calculated Molecular Weight | 303 aa, 34 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC015799 |
| Gene Symbol | Caspase 7 |
| Gene ID (NCBI) | 840 |
| RRID | AB_2880779 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55210 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caspase 7 antibody 27155-1-AP | Download protocol |
| IP protocol for Caspase 7 antibody 27155-1-AP | Download protocol |
| WB protocol for Caspase 7 antibody 27155-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model | ||
J Pineal Res Melatonin synergizes the chemotherapeutic effect of 5-fluorouracil in colon cancer by suppressing PI3K/AKT and NF-κB/iNOS signaling pathways. | ||
Front Immunol Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma | ||
Phytother Res Targeting HSP90 with picropodophyllin suppresses gastric cancer tumorigenesis by disrupting the association of HSP90 and AKT | ||
Cell Death Discov IDO1 inhibits ferroptosis by regulating FTO-mediated m6A methylation and SLC7A11 mRNA stability during glioblastoma progression |

























