Cathepsin C Polyclonal antibody, PBS Only

• 

  WB analysis using 30790-1-AP (same clone as 30790-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30790-1-AP (Cathepsin C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 30790-1-AP (same clone as 30790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 30790-1-AP (Cathepsin C antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30790-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 30790-1-AP (same clone as 30790-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using Cathepsin C antibody (30790-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30790-1-PBS in a different storage buffer formulation.

Cathepsin C Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30790-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CTSC, CPPI

---

Product Information

30790-1-PBS targets Cathepsin C in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32420

  Product name: Recombinant human Cathepsin C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-463 aa of NM_001814

  Sequence: LPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL

• Full Name: cathepsin C
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_001814
• Gene Symbol: Cathepsin C
• Gene ID (NCBI): 1075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53634
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cathepsin C, also known as DPP-I. It is expected to be located in lysosome and highly expressed in lung, kidney and placenta (PMID: 9092576). This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. The calculated molecular weight of Cathepsin C is 51 kDa. The 23-kDa band may be a subunit of the protein monomer, while a 100-kda band is a dimer form (PMID: 26884336, 31557781).