Tested Applications
| Positive WB detected in | mouse heart tissue, mouse colon tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse heart tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
| Positive IF/ICC detected in | H9C2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28358-1-AP targets Caveolin-3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28009 Product name: Recombinant human Caveolin-3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC069368 Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD Predict reactive species |
| Full Name | caveolin 3 |
| Calculated Molecular Weight | 151 aa, 17 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC069368 |
| Gene Symbol | Caveolin-3 |
| Gene ID (NCBI) | 859 |
| RRID | AB_2881120 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56539 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caveolin-3 antibody 28358-1-AP | Download protocol |
| IHC protocol for Caveolin-3 antibody 28358-1-AP | Download protocol |
| WB protocol for Caveolin-3 antibody 28358-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Caveolin-3 Polyclonal antibody (Cat# 28358-1-AP) has 5 total citations. These appear in Cell Metabolism, Oxidative Medicine and Cellular Longevity, PLoS Genetics, International Heart Journal, and bioRxiv. The research fields span liver fibrosis, myometrial smooth muscle function in premature labor, heart failure and cardiomyopathy susceptibility, pressure overload-induced cardiac remodeling, and neural lineage identity during cerebellar development.
| Species | Application | Title |
|---|---|---|
Cell Metab Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining | ||
Oxid Med Cell Longev Trophoblasts Modulate the Ca2+ Oscillation and Contraction of Myometrial Smooth Muscle Cells by Small Extracellular Vesicle- (sEV-) Mediated Exporting of miR-25-3p during Premature Labor. | ||
PLoS Genet Genome-wide analysis identifies susceptibility loci for heart failure and nonischemic cardiomyopathy subtype in the East Asian populations. | ||
Int Heart J Decrease in Caveolae-Gαq Interaction Mediates Pressure Overload-Induced Cardiac Remodeling in Rats | ||
bioRxiv Active repression of muscle fate preserves neural lineage identity during cerebellum development. |
