Product Information
85861-1-PBS targets Ccl19 as part of a matched antibody pair:
MP02165-1: 85861-3-PBS capture and 85861-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3124 Product name: Recombinant Mouse CCL19/MIP-3 beta protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 26-108 aa of NM_011888.2 Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 19 |
| Calculated Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_011888.2 |
| Gene Symbol | Ccl19 |
| Gene ID (NCBI) | 24047 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O70460 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







