Ccr5 Polyclonal antibody

• 

Ccr5 Polyclonal Antibody for ELISA

Cat No. 50650-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IHC, IF, ELISA

Synonyms

C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CD195

---

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

50650-1-AP targets Ccr5 in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0577

  Product name: Recombinant mouse Ccr5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 270-354 aa of BC103587

  Sequence: NCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL

• Full Name: chemokine (C-C motif) receptor 5
• Calculated Molecular Weight: 40 kDa
• GenBank Accession Number: BC103587
• Gene Symbol: Ccr5
• Gene ID (NCBI): 12774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51682
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	IHC,IF	Brain Behav; Downregulation of CCR5 on brain perivascular macrophages in simian immunodeficiency virus-infected rhesus macaques; Authors - Julian B Hattler