Product Information
66167-1-PBS targets Claudin 18 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15517 Product name: Recombinant human CLDN18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 185-261 aa of BC146668 Sequence: TLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV Predict reactive species |
Full Name | claudin 18 |
Calculated Molecular Weight | 261 aa, 28 kDa |
Observed Molecular Weight | 29 kDa |
GenBank Accession Number | BC146668 |
Gene Symbol | CLDN18 |
Gene ID (NCBI) | 51208 |
RRID | AB_2881563 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P56856 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Claudin 18 (CLDN18) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 11585919; 18036336). Claudins exhibit specific patterns of expression in different tissues (PMID: 15447685). CLDN18 is specifically expressed in the stomach and lung. CLDN18 has two alternatively spliced variants, CLDN18.1 and CLDN18.2. CLDN18.2 is a highly selective gastric lineage marker that determines the gastric phenotype in a neoplastic condition, whereas CLDN18.1 is lung specific (PMID: 11585919; 21832145). Altered CLDN18 expression has been reported in various human malignancies, including gastric cancer, lung adenocarcinoma, and pancreatic neoplasm (PMID: 17459057; 22076167; 21832145). This antibody can recognize both CLDN18.1 and CLDN18.2.