Claudin 18 Monoclonal antibody, PBS Only

Claudin 18 Monoclonal Antibody for IHC, IP, Indirect ELISA
Cat No. 66167-1-PBS
Clone No.5G7F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IHC, IP, Indirect ELISA

UNQ778/PRO1572, CLDN18, Claudin-18, Claudin18, 5G7F2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66167-1-PBS targets Claudin 18 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15517

Product name: Recombinant human CLDN18 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 185-261 aa of BC146668

Sequence: TLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV

Predict reactive species
Full Name claudin 18
Calculated Molecular Weight 261 aa, 28 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC146668
Gene Symbol CLDN18
Gene ID (NCBI) 51208
RRIDAB_2881563
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56856
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Claudin 18 (CLDN18) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 11585919; 18036336). Claudins exhibit specific patterns of expression in different tissues (PMID: 15447685). CLDN18 is specifically expressed in the stomach and lung. CLDN18 has two alternatively spliced variants, CLDN18.1 and CLDN18.2. CLDN18.2 is a highly selective gastric lineage marker that determines the gastric phenotype in a neoplastic condition, whereas CLDN18.1 is lung specific (PMID: 11585919; 21832145). Altered CLDN18 expression has been reported in various human malignancies, including gastric cancer, lung adenocarcinoma, and pancreatic neoplasm (PMID: 17459057; 22076167; 21832145). This antibody can recognize both CLDN18.1 and CLDN18.2.

Loading...
||
New chat Able
正在加载,请稍候...