Connexin 43 Polyclonal antibody

• 

  WB analysis using 26980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 26980-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 26980-1-AP

  IP result of anti-Connexin 43 (IP:26980-1-AP, 4ug; Detection:26980-1-AP 1:500) with mouse heart tissue lysate 4000 ug.

• 

  IHC staining of rat heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26980-1-AP (Connexin 43 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 26980-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26980-1-AP (Connexin 43 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and 66895-1-Ig (alpha Actinin mouse mAb) at dilution of 1:50, further stained with CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) for 26980-1-AP, and CoraLite594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) for 66895-1-Ig.

• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Connexin 43 antibody (26980-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human heart using 26980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human heart tissue using 26980-1-AP (Connexin 43 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Connexin 43 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 26980-1-AP

Publications(81)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

Synonyms

GJA1, Connexin-43, GJAL, Gap junction alpha-1 protein, Gap junction alpha 1 protein

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse testis tissue, mouse heart tissue, rat brain tissue, rat heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: rat heart tissue, mouse heart tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue, human heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:3000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 64 publications below
• IHC: See 11 publications below
• IF: See 29 publications below
• IP: See 3 publications below
• FC: See 1 publications below
• CoIP: See 1 publications below

Product Information

26980-1-AP targets Connexin 43 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25533

  Product name: Recombinant human Connexin 43 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 232-382 aa of BC026329

  Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

• Full Name: gap junction protein, alpha 1, 43kDa
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43-47 kDa
• GenBank Accession Number: BC026329
• Gene Symbol: Connexin-43
• Gene ID (NCBI): 2697
• RRID: AB_2880711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17302
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Acta Pharm Sin B; Converting bacteria into autologous tumor vaccine via surface biomineralization of calcium carbonate for enhanced immunotherapy; Authors - Lina Guo
rat	WB,IF	Adv Healthc Mater; A ROS-Responsive Liposomal Composite Hydrogel Integrating Improved Mitochondrial Function and Pro-Angiogenesis for Efficient Treatment of Myocardial Infarction.; Authors - Zhi Zheng
mouse	WB,IF	Drug Des Devel Ther; Shensong Yangxin Capsule Reduces the Susceptibility of Arrhythmia in db/db Mice via Inhibiting the Inflammatory Response Induced by Endothelium Dysfunction; Authors - Jiehan Zhang
human,mouse	WB	Cell Commun Signal; Extracellular vesicular delivery of ceramides from pulmonary macrophages to endothelial cells facilitates chronic obstructive pulmonary disease; Authors - Qiqing Huang
mouse	WB,IF	Cell Mol Biol Lett; Robo4 inhibits gamma radiation-induced permeability of a murine microvascular endothelial cell by regulating the junctions; Authors - Seyram Yao Adzraku
mouse	WB	Cell Mol Life Sci; Connexin 43 contributes to perioperative neurocognitive disorder by attenuating perineuronal net of hippocampus in aged mice; Authors - Qian Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Muhammad (Verified Customer) (08-30-2022)

Cx43 antibody used is excellent and working in HUVEC cells.

• Applications: Western Blot
• Cell Tissue Type: HUVEC

FH

ABDULLAH (Verified Customer) (11-08-2019)

This antibody worked great!It detected the protein at the right size.There wasn't any background.

• Applications: Western Blot, Immunofluorescence,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: BEND.3 cells