Connexin 43 Polyclonal antibody

Connexin 43 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 26980-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, CoIP, ELISA

GJA1, Connexin-43, GJAL, Gap junction alpha-1 protein, Gap junction alpha 1 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse testis tissue, mouse heart tissue, rat brain tissue, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inrat heart tissue, mouse heart tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue, human heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:3000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26980-1-AP targets Connexin 43 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25533

Product name: Recombinant human Connexin 43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 232-382 aa of BC026329

Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Predict reactive species
Full Name gap junction protein, alpha 1, 43kDa
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43-47 kDa
GenBank Accession NumberBC026329
Gene Symbol Connexin-43
Gene ID (NCBI) 2697
RRIDAB_2880711
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17302
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Connexin-43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Cx43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490).

Protocols

Product Specific Protocols
IF protocol for Connexin 43 antibody 26980-1-APDownload protocol
IHC protocol for Connexin 43 antibody 26980-1-APDownload protocol
IP protocol for Connexin 43 antibody 26980-1-APDownload protocol
WB protocol for Connexin 43 antibody 26980-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Acta Pharm Sin B

Converting bacteria into autologous tumor vaccine via surface biomineralization of calcium carbonate for enhanced immunotherapy

Authors - Lina Guo
ratWB,IF

Adv Healthc Mater

A ROS-Responsive Liposomal Composite Hydrogel Integrating Improved Mitochondrial Function and Pro-Angiogenesis for Efficient Treatment of Myocardial Infarction.

Authors - Zhi Zheng
mouseWB,IF

Drug Des Devel Ther

Shensong Yangxin Capsule Reduces the Susceptibility of Arrhythmia in db/db Mice via Inhibiting the Inflammatory Response Induced by Endothelium Dysfunction

Authors - Jiehan Zhang
human,mouseWB

Cell Commun Signal

Extracellular vesicular delivery of ceramides from pulmonary macrophages to endothelial cells facilitates chronic obstructive pulmonary disease

Authors - Qiqing Huang
mouseWB,IF

Cell Mol Biol Lett

Robo4 inhibits gamma radiation-induced permeability of a murine microvascular endothelial cell by regulating the junctions

Authors - Seyram Yao Adzraku
mouseWB

Cell Mol Life Sci

Connexin 43 contributes to perioperative neurocognitive disorder by attenuating perineuronal net of hippocampus in aged mice

Authors - Qian Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Muhammad (Verified Customer) (08-30-2022)

Cx43 antibody used is excellent and working in HUVEC cells.

  • Applications: Western Blot
  • Cell Tissue Type: HUVEC
FH

ABDULLAH (Verified Customer) (11-08-2019)

This antibody worked great!It detected the protein at the right size.There wasn't any background.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: BEND.3 cells
Loading...
||
New chat Able
正在加载,请稍候...