Tested Applications
| Positive WB detected in | mouse lung tissue |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31087-1-AP targets CXL15 in WB, IHC, IP, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33964 Product name: Recombinant mouse Cxcl15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC061138 Sequence: QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 15 |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC061138 |
| Gene Symbol | Cxcl15 |
| Gene ID (NCBI) | 20309 |
| RRID | AB_3669847 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9WVL7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cxcl15, also known as lungkine or WECHE, is a small cytokine belonging to the CXC chemokine family that has been described in the mouse. High levels of Cxcl15 mRNA were specifically detected in the lung and at lower levels in fetal lung tissue by Northern blot and in situ hybridization, suggesting a potential role for this chemokine during lung development. Moreover, the Cxcl15 protein is secreted into the airway spaces and induces the in vitro and in vivo migration of neutrophils, suggesting that it is involved in lung-specific neutrophil trafficking.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXL15 antibody 31087-1-AP | Download protocol |
| IP protocol for CXL15 antibody 31087-1-AP | Download protocol |
| WB protocol for CXL15 antibody 31087-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







