CoraLite® Plus 488-conjugated Cyclin D3 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66357

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 Cyclin D3 antibody (CL488-66357, Clone: 1F2C6 ) at dilution of 1:600.

• 

  FC experiment of HeLa using CL488-66357

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human Cyclin D3 (CL488-66357, Clone:1F2C6) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

Cyclin D3 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66357

Clone No.1F2C6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

CCND3, G1/S-specific cyclin-D3, G1/S specific cyclin D3, Cyclin D, 1F2C6

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66357 targets Cyclin D3 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22825

  Product name: Recombinant human Cyclin D3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-292 aa of BC011616

  Sequence: MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

• Full Name: cyclin D3
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC011616
• Gene Symbol: Cyclin D3
• Gene ID (NCBI): 896
• ENSEMBL Gene ID: ENSG00000112576
• RRID: AB_3084236
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P30281
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cyclin D3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activitiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation.