Cyp4a12a Polyclonal antibody

• 

  WB analysis of mouse liver using 51157-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 51157-1-AP (Cyp4a12a antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat liver using 51157-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 51157-1-AP (Cyp4a12a antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 51157-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 51157-1-AP (Cyp4a12a antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Cyp4a12a Polyclonal Antibody for WB, IHC, ELISA

Cat No. 51157-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat, human

Applications

WB, IHC, ELISA

Synonyms

Cyp4a12, Cyp4a12a

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

51157-1-AP targets Cyp4a12a in WB, IHC, ELISA applications and shows reactivity with mouse, rat, human samples.

• Tested Reactivity: mouse, rat, human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0509

  Product name: Recombinant mouse Cyp4a12a protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 248-508 aa of NM_177406

  Sequence: CKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ

• Full Name: cytochrome P450, family 4, subfamily a, polypeptide 12a
• Observed Molecular Weight: 58-70 kDa
• GenBank Accession Number: NM_177406
• Gene Symbol: Cyp4a12a
• Gene ID (NCBI): 277753
• RRID: AB_2881255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q91WL5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. Mouse Cyp4a12a oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. For modification, the MW of Cyp4a12a is about 58-70 kDa in western blot detection.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Exp Cell Res; Effects of PPARs/20-HETE on the renal impairment under diabetic conditions.; Authors - Shumei Ding