Cyp4a12a Polyclonal antibody

Cyp4a12a Polyclonal Antibody for WB, IHC, ELISA
Cat No. 51157-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat, human

Applications

WB, IHC, ELISA

Cyp4a12, Cyp4a12a

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IHC detected inrat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

51157-1-AP targets Cyp4a12a in WB, IHC, ELISA applications and shows reactivity with mouse, rat, human samples.

Tested Reactivity mouse, rat, human
Cited Reactivityrat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0509

Product name: Recombinant mouse Cyp4a12a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 248-508 aa of NM_177406

Sequence: CKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ

Predict reactive species
Full Name cytochrome P450, family 4, subfamily a, polypeptide 12a
Observed Molecular Weight 58-70 kDa
GenBank Accession NumberNM_177406
Gene Symbol Cyp4a12a
Gene ID (NCBI) 277753
RRIDAB_2881255
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ91WL5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. Mouse Cyp4a12a oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. For modification, the MW of Cyp4a12a is about 58-70 kDa in western blot detection.

Protocols

Product Specific Protocols
IHC protocol for Cyp4a12a antibody 51157-1-APDownload protocol
WB protocol for Cyp4a12a antibody 51157-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Exp Cell Res

Effects of PPARs/20-HETE on the renal impairment under diabetic conditions.

Authors - Shumei Ding
Loading...
||
New chat Able
正在加载,请稍候...