Tested Applications
Positive WB detected in | human saliva tissue |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
26979-1-AP targets Cystatin S in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25619 Product name: Recombinant human CST4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-141 aa of BC065714 Sequence: TCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA Predict reactive species |
Full Name | cystatin S |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | BC065714 |
Gene Symbol | Cystatin S |
Gene ID (NCBI) | 1472 |
RRID | AB_2880710 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P01036 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cystatins are a family of inhibitors of cysteine peptidases that comprises the salivary cystatins D and S-type (including CST5 and CST4,1,2) and cystatin C-type (CST3) (PMID: 25329717). The D and S-type cystatin have also been detected in seminal plasma, tears, and tracheobronchial fluid but not in other fluids and secretions where cystatin C is found. And the CST4 was expressed in the serous acinar and demilune cells of the human submandibular gland and at lower levels in the serous acini of the parotid gland (PMID:11879580). CST4 specifically combines with cysteine protease to regulate its activity, thus preventing hydrolysis of the extracellular matrix. And some studies propose that CST4 might be a biomarker for gastrointestinal cancer (PMID:29218251; PMID:29636621).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cystatin S antibody 26979-1-AP | Download protocol |
IHC protocol for Cystatin S antibody 26979-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |