• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Cytokeratin 13 Monoclonal antibody

Cytokeratin 13 Monoclonal Antibody for IF-P
Cat No. CL488-66684
Clone No.1E10G2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF-P

KRT13, Cytokeratin,Keratin, ck17, CK-13, CK13

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman cervical cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-66684 targets Cytokeratin 13 in IF-P applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0217

Product name: Recombinant human KRT13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-458 aa of BC002661

Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

Predict reactive species
Full Name keratin 13
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC002661
Gene Symbol Cytokeratin 13
Gene ID (NCBI) 3860
RRIDAB_2919357
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP13646
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. The Keratin 13 (KRT13) gene encodes a type I acidic keratin which is expressed in the differentiated cells of non-cornified stratified squamous epithelia.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Cytokeratin 13 antibody CL488-66684Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Int J Mol Sci

Shedding Light on Viral Shedding: Novel Insights into Nuclear Assembly, Cytoplasmic Transformation and Extracellular Vesicle Release of the BK Virus

Authors - Daniela Gerges
Loading...
||
New chat Able
正在加载,请稍候...