CoraLite®594-conjugated Cytokeratin 13 Monoclonal antibody

• 

  IF Staining of human cervical cancer using CL594-66684

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using CoraLite®594 Cytokeratin 13 antibody (CL594-66684, Clone: 1E10G2 ) at dilution of 1:100.

• 

  IF Staining of human cervical cancer using CL594-66684

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using CoraLite®594 Cytokeratin 13 antibody (CL594-66684, Clone: 1E10G2 ) at dilution of 1:100.

• 

  IF Staining of HaCaT using CL594-66684

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using CoraLite®594 Cytokeratin 13 antibody (CL594-66684, Clone: 1E10G2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Cytokeratin 13 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL594-66684

Clone No.1E10G2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC, IF-P

Synonyms

KRT13, 1E10G2, CK 13, CK13, CK-13

---

Tested Applications

• Positive IF-P detected in: human cervical cancer tissue
• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66684 targets Cytokeratin 13 in IF/ICC, IF-P applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0217

  Product name: Recombinant human KRT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-458 aa of BC002661

  Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

• Full Name: keratin 13
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC002661
• Gene Symbol: Cytokeratin 13
• Gene ID (NCBI): 3860
• RRID: AB_2920022
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13646
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. The Keratin 13 (KRT13) gene encodes a type I acidic keratin which is expressed in the differentiated cells of non-cornified stratified squamous epithelia.