Cytokeratin 13 Monoclonal antibody

• 

  WB analysis of A431 using 66684-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66684-1-Ig (KRT13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 66684-1-Ig

  WB result of Cytokeratin 13 antibody (66684-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytokeratin 13 transfected A431 cells.

• 

  WB analysis of rat skin using 66684-1-Ig

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66684-1-Ig (KRT13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66684-1-Ig (KRT13 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66684-1-Ig (KRT13 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66684-1-Ig (Cytokeratin 13 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66684-1-Ig (Cytokeratin 13 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66684-1-Ig (Cytokeratin 13 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66684-1-Ig (Cytokeratin 13 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus cancer using 66684-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66684-1-Ig (Cytokeratin 13 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human cervical cancer using 66684-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human cervical cancer tissue using Cytokeratin 13 antibody (66684-1-Ig, Clone: 1E10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  Affinity and Kinetic Characterization of 66684-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 66684-1-Ig against Human Cytokeratin 13 was performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

Cytokeratin 13 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66684-1-Ig

Clone No.1E10G2

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

KRT13, 1E10G2, CK 13, CK13, CK-13

---

Tested Applications

• Positive WB detected in: A431 cells, rat skin tissue
• Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human cervical cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66684-1-Ig targets Cytokeratin 13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0217

  Product name: Recombinant human KRT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-458 aa of BC002661

  Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

• Full Name: keratin 13
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC002661
• Gene Symbol: Cytokeratin 13
• Gene ID (NCBI): 3860
• RRID: AB_2882038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P13646
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. The Keratin 13 (KRT13) gene encodes a type I acidic keratin which is expressed in the differentiated cells of non-cornified stratified squamous epithelia. This antibody can react with Cytokeratin 15.