Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human tonsillitis tissue, human colon tissue, mouse skin tissue, rat skin tissue, human brown disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
27105-1-AP targets Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25844 Product name: Recombinant human KRT8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-50 aa of BC008200 Sequence: EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL Predict reactive species |
| Full Name | keratin 8 |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC008200 |
| Gene Symbol | Cytokeratin 8 |
| Gene ID (NCBI) | 3856 |
| RRID | AB_2918117 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05787 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT8 is often paired with keratin 18 in vivo.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
| IHC protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
| WB protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Cancer Identification and validation of a novel apoptosis-related prognostic risk score model for lung adenocarcinoma | ||
J Transl Med Single-cell transcriptomic analysis reveals characteristic feature of macrophage reprogramming in liver Mallory-Denk bodies pathogenesis | ||
Environ Toxicol Multidimensional progressive single-cell sequencing reveals cell microenvironment composition and cancer heterogeneity in lung cancer | ||
Transl Lung Cancer Res Identification of lysosomal genes associated with prognosis in lung adenocarcinoma |



























