Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells |
Positive IHC detected in | human tonsillitis tissue, human colon tissue, mouse skin tissue, rat skin tissue, human brown disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 2 publications below |
IF | See 1 publications below |
Product Information
27105-1-AP targets Cytokeratin 8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25844 Product name: Recombinant human KRT8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 11-50 aa of BC008200 Sequence: EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL Predict reactive species |
Full Name | keratin 8 |
Calculated Molecular Weight | 54 kDa |
Observed Molecular Weight | 52 kDa |
GenBank Accession Number | BC008200 |
Gene Symbol | Cytokeratin 8 |
Gene ID (NCBI) | 3856 |
RRID | AB_2918117 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05787 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. KRT8 is often paired with keratin 18 in vivo.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
IHC protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
IF protocol for Cytokeratin 8 antibody 27105-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Transl Lung Cancer Res Identification of lysosomal genes associated with prognosis in lung adenocarcinoma | ||
Environ Toxicol Multidimensional progressive single-cell sequencing reveals cell microenvironment composition and cancer heterogeneity in lung cancer | ||
J Cancer Identification and validation of a novel apoptosis-related prognostic risk score model for lung adenocarcinoma | ||
J Transl Med Single-cell transcriptomic analysis reveals characteristic feature of macrophage reprogramming in liver Mallory-Denk bodies pathogenesis |