Tested Applications
Positive WB detected in | HEK-293 cells, HepG2 cells |
Positive IP detected in | HepG2 cells |
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
10531-1-AP targets DAD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0814 Product name: Recombinant human DAD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC007403 Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG Predict reactive species |
Full Name | defender against cell death 1 |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 16-20 kDa |
GenBank Accession Number | BC007403 |
Gene Symbol | DAD1 |
Gene ID (NCBI) | 1603 |
RRID | AB_2089878 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61803 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DAD1 (defender against cell death 1) is a downstream target of the NFkB survival pathway and exhibits an antiapoptotic function. It is also named as OST2 (Oligosaccharyl transferase2) and catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Increased expression of DAD1 has been observed in various tumors.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DAD1 antibody 10531-1-AP | Download protocol |
IHC protocol for DAD1 antibody 10531-1-AP | Download protocol |
IP protocol for DAD1 antibody 10531-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |