Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10531-1-AP targets DAD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0814 Product name: Recombinant human DAD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC007403 Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG Predict reactive species |
| Full Name | defender against cell death 1 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 16-20 kDa |
| GenBank Accession Number | BC007403 |
| Gene Symbol | DAD1 |
| Gene ID (NCBI) | 1603 |
| RRID | AB_2089878 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61803 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DAD1 (defender against cell death 1) is a downstream target of the NFkB survival pathway and exhibits an antiapoptotic function. It is also named as OST2 (Oligosaccharyl transferase2) and catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Increased expression of DAD1 has been observed in various tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DAD1 antibody 10531-1-AP | Download protocol |
| IP protocol for DAD1 antibody 10531-1-AP | Download protocol |
| WB protocol for DAD1 antibody 10531-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







