DAZ Polyclonal antibody, PBS Only

• 

  WB analysis of human testis using 14065-1-AP (same clone as 14065-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 14065-1-AP (DAZ4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14065-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 14065-1-AP (same clone as 14065-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 14065-1-AP (DAZ4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14065-1-PBS in a different storage buffer formulation.

DAZ Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14065-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

DAZ4, DAZ 4, DAZ1, pDP1680, pDP1681

---

Product Information

14065-1-PBS targets DAZ in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5116

  Product name: Recombinant human DAZ4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-343 aa of BC047617

  Sequence: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSA

• Full Name: deleted in azoospermia 4
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC047617
• Gene Symbol: DAZ4
• Gene ID (NCBI): 57135
• RRID: AB_2878008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86SG3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAZ4, encoded by the DAZ gene, is an RNA-binding protein with a role in spermatogenesis. DAZ4 is a testis-specific protein that expression restricted to premeiotic germ cells, particularly in spermatogonia. Defects in DAZ4 may be a cause of spermatogenic failure Y-linked type 2 (SPGFY2). It is a disorder resulting in the absence (azoospermia) or reduction (oligozoospermia) of sperm in the semen, leading to male infertility.