Tested Applications
| Positive WB detected in | SH-SY5Y cells, mouse brain tissue, rat brain tissue | 
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
27623-1-AP targets DBNDD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag26356 Product name: Recombinant human DBNDD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-161 aa of BC001105 Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Predict reactive species | 
                                    
| Full Name | dysbindin (dystrobrevin binding protein 1) domain containing 2 | 
| Calculated Molecular Weight | 261 aa, 28 kDa | 
| Observed Molecular Weight | 28-29 kDa | 
| GenBank Accession Number | BC001105 | 
| Gene Symbol | DBNDD2 | 
| Gene ID (NCBI) | 55861 | 
| RRID | AB_2880927 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9BQY9 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DBNDD2 antibody 27623-1-AP | Download protocol | 
| WB protocol for DBNDD2 antibody 27623-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







