Tested Applications
| Positive WB detected in | SH-SY5Y cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27623-1-AP targets DBNDD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26356 Product name: Recombinant human DBNDD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-161 aa of BC001105 Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Predict reactive species |
| Full Name | dysbindin (dystrobrevin binding protein 1) domain containing 2 |
| Calculated Molecular Weight | 261 aa, 28 kDa |
| Observed Molecular Weight | 28-29 kDa |
| GenBank Accession Number | BC001105 |
| Gene Symbol | DBNDD2 |
| Gene ID (NCBI) | 55861 |
| RRID | AB_2880927 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BQY9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DBNDD2 antibody 27623-1-AP | Download protocol |
| WB protocol for DBNDD2 antibody 27623-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cells CK1BP Reduces α-Synuclein Oligomerization and Aggregation Independent of Serine 129 Phosphorylation. | ||
Front Med Suppressing DBNDD2 promotes neuron growth and axon regeneration in adult mammals |







