DBNDD2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 27623-1-AP (same clone as 27623-1-PBS)

  mouse and rat brain tissues were subjected to SDS PAGE followed by western blot with 27623-1-AP (DBNDD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27623-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 27623-1-AP (same clone as 27623-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 27623-1-AP (DBNDD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 27623-1-AP (same clone as 27623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27623-1-AP (DBNDD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 27623-1-AP (same clone as 27623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27623-1-AP (DBNDD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27623-1-PBS in a different storage buffer formulation.

DBNDD2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27623-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27623-1-PBS targets DBNDD2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26356

  Product name: Recombinant human DBNDD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-161 aa of BC001105

  Sequence: DTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

• Full Name: dysbindin (dystrobrevin binding protein 1) domain containing 2
• Calculated Molecular Weight: 261 aa, 28 kDa
• Observed Molecular Weight: 28-29 kDa
• GenBank Accession Number: BC001105
• Gene Symbol: DBNDD2
• Gene ID (NCBI): 55861
• RRID: AB_2880927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQY9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.