DBR1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66951-1-Ig (same clone as 66951-1-PBS)

  WB result of DBR1 antibody (66951-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DBR1 transfected HeLa cells. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66951-1-Ig (same clone as 66951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66951-1-Ig (same clone as 66951-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66951-1-Ig (same clone as 66951-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66951-1-Ig (same clone as 66951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66951-1-Ig (same clone as 66951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66951-1-Ig (same clone as 66951-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66951-1-Ig (DBR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 66951-1-Ig (same clone as 66951-1-PBS)

  IP result of anti-DBR1 (IP:66951-1-Ig, 4ug; Detection:66951-1-Ig 1:2000) with HeLa cells lysate 1560 ug. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 66951-1-Ig (same clone as 66951-1-PBS)

  IP result of anti-DBR1 (IP:66951-1-Ig, 4ug; Detection:66951-1-Ig 1:2000) with mouse brain tissue lysate 1280 ug. This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66951-1-Ig (same clone as 66951-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66951-1-Ig (DBR1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66951-1-Ig (same clone as 66951-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66951-1-Ig (DBR1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 66951-1-Ig (same clone as 66951-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DBR1 antibody (66951-1-Ig, Clone: 3B5A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66951-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DBR1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 66951-1-PBS

Clone No.3B5A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

DBR1, Lariat debranching enzyme

---

Product Information

66951-1-PBS targets DBR1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8830

  Product name: Recombinant human DBR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 204-544 aa of BC009472

  Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA

• Full Name: debranching enzyme homolog 1 (S. cerevisiae)
• Calculated Molecular Weight: 544 aa, 62 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC009472
• Gene Symbol: DBR1
• Gene ID (NCBI): 51163
• RRID: AB_2882274
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UK59
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.