• Featured Product
  • KD/KO Validated

DBR1 Monoclonal antibody

DBR1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 66951-1-Ig
Clone No.3B5A7

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IHC, IF/ICC, IP, ELISA

DBR1, Lariat debranching enzyme

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman brain tissue, HeLa cells, MCF-7 cells, fetal human brain tissue, pig brain tissue, rat brain tissue, mouse brain tissue, HepG2 cells
Positive IP detected inHeLa cells, mouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66951-1-Ig targets DBR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

Tested Reactivity Human, Mouse, Rat, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8830

Product name: Recombinant human DBR1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 204-544 aa of BC009472

Sequence: TLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQAKDKGQTARATKFLALDKCLPHRDFLQILEIEHDPSAPDYLEYDIEWLTILRATDDLINVTGRLWNMPENNGLHARWDYSATEEGMKEVLEKLNHDLKVPCNFSVTAACYDPSKPQTQMQLIHRINPQTTEFCAQLGIIDINVRLQKSKEEHHVCGEYEEQDDVESNDSGEDQSEYNTDTSALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDDDDDDAA

Predict reactive species
Full Name debranching enzyme homolog 1 (S. cerevisiae)
Calculated Molecular Weight 544 aa, 62 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC009472
Gene Symbol DBR1
Gene ID (NCBI) 51163
RRIDAB_2882274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UK59
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DBR1(Lariat debranching enzyme) hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules. DBR1 belongs to the lariat debranching enzyme family. Inhibiton of Dbr1 can suppress TDP-43 toxicity in primary neurons, suggesting that Dbr1 could be a potential therapeutic target for ALS and related TDP-43 proteinopathies (PMID: 23104007). This protein has 2 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
IF protocol for DBR1 antibody 66951-1-IgDownload protocol
IHC protocol for DBR1 antibody 66951-1-IgDownload protocol
IP protocol for DBR1 antibody 66951-1-IgDownload protocol
WB protocol for DBR1 antibody 66951-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (11-10-2024)

Antibody were used for Dbr1 detection in human RKO cells. Great sensitivity and specificity

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: RKO
DBR1 Antibody Western Blot validation (1:10000 dilution) in RKO (Cat no:66951-1-Ig)
FH

Moritz (Verified Customer) (09-12-2024)

HEK293T cells: antibody worked extremely well in WB (1:10k), as well as in IF (1:500)

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: HEK293T
DBR1 Antibody Western Blot,Immunofluorescence validation (1:10000 dilution) in HEK293T (Cat no:66951-1-Ig)
FH

Tsimafei (Verified Customer) (08-07-2024)

Excellent antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mESCs
DBR1 Antibody Western Blot validation (1:10000 dilution) in mESCs (Cat no:66951-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...