DCLK1 Polyclonal antibody, PBS Only

DCLK1 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA
Cat No. 29800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

DCAMKL1, DCDC3A, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1, Doublecortin-like kinase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29800-1-PBS targets DCLK1 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32007

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 648-740 aa of NM_004734

Sequence: NDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight82KD
Observed Molecular Weight48 kDa, 82 kDa
GenBank Accession NumberNM_004734
Gene Symbol DCLK1
Gene ID (NCBI) 9201
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15075
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...