Use Able AI chat for product recommendations

DCLK1 Polyclonal antibody

DCLK1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 29800-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

DCAMKL1, DCDC3A, Doublecortin domain-containing protein 3A, Doublecortin-like and CAM kinase-like 1, Doublecortin-like kinase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29800-1-AP targets DCLK1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32007

Product name: Recombinant human DCLK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 648-740 aa of NM_004734

Sequence: NDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF

Predict reactive species
Full Name doublecortin-like kinase 1
Calculated Molecular Weight82KD
Observed Molecular Weight48 kDa, 82 kDa
GenBank Accession NumberNM_004734
Gene Symbol DCLK1
Gene ID (NCBI) 9201
RRIDAB_3086165
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15075
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa.

Protocols

Product Specific Protocols
IF protocol for DCLK1 antibody 29800-1-APDownload protocol
IHC protocol for DCLK1 antibody 29800-1-APDownload protocol
IP protocol for DCLK1 antibody 29800-1-APDownload protocol
WB protocol for DCLK1 antibody 29800-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...