DCLRE1B Polyclonal antibody

• 

  WB analysis of Jurkat using 13203-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13203-1-AP (DCLRE1B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13203-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13203-1-AP (DCLRE1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DCLRE1B Polyclonal Antibody for WB, ELISA

Cat No. 13203-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

5 exonuclease Apollo, 5' exonuclease Apollo, APOLLO, Beta-lactamase DCLRE1B, DNA cross-link repair 1B protein

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

13203-1-AP targets DCLRE1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3945

  Product name: Recombinant human DCLRE1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-532 aa of BC029687

  Sequence: SLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC

• Full Name: DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae)
• Calculated Molecular Weight: 532 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC029687
• Gene Symbol: DCLRE1B
• Gene ID (NCBI): 64858
• RRID: AB_2292695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H816
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interstrand cross-links (ICLs) is an extremely cytotoxic form of DNA damage that covalently tethers the two strands of the double helix, which inhibits fundamental nuclear functions, including transcription and DNA replication [PMID:21701511]. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links [PMID:10848582]. Furthermore, DCLRE1B was identified as a TRF2-interacting protein and, has a role in telomere maintenance in association with the Shelterin complex, preventing non-homologous end-joining-mediated chromosome fusions protecting leading strand telomeres [PMID:20619712].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Struct Mol Biol; Fanconi anemia DNA crosslink repair factors protect against LINE-1 retrotransposition during mouse development; Authors - Nazareno Bona
human	WB	Sci Rep; DCLRE1B as a novel prognostic biomarker associated with immune infiltration: a pancancer analysis; Authors - Mi Zou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Daniel (Verified Customer) (02-24-2025)

Antibody does not specifically recognize DCLRE1B. A band can still be detected in DCLRE1B knockdown cells.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: RPE1