DCTN5 Polyclonal antibody, PBS Only

• 

  IHC staining of human breast cancer using 10182-1-AP (same clone as 10182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10182-1-AP (DCTN5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10182-1-AP (same clone as 10182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10182-1-AP (DCTN5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10182-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DCTN5 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10182-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

10182-1-PBS targets DCTN5 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0234

  Product name: Recombinant human DCTN5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-182 aa of BC004191

  Sequence: ELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

• Full Name: dynactin 5 (p25)
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: BC004191
• Gene Symbol: DCTN5
• Gene ID (NCBI): 84516
• RRID: AB_2088344
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTE1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.