DDAH1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68823-1-Ig (same clone as 68823-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68823-1-Ig (DDAH1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68823-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68823-1-Ig (same clone as 68823-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68823-1-Ig (DDAH1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68823-1-PBS in a different storage buffer formulation.

DDAH1 Monoclonal Antibody for WB, ELISA

Cat No. 68823-1-PBS

Clone No.1A1A6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

Synonyms

DDAH, DDAH 1, DDAH1, DDAHI, Dimethylargininase 1, FLJ21264, FLJ25539

---

Product Information

68823-1-PBS targets DDAH1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32840

  Product name: Recombinant human DDAH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 168-285 aa of NM_012137

  Sequence: VADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS

• Full Name: dimethylarginine dimethylaminohydrolase 1
• Calculated Molecular Weight: 31kd
• GenBank Accession Number: NM_012137
• Gene Symbol: DDAH1
• Gene ID (NCBI): 23576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O94760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dimethylarginine dimethylaminohydrolase 1 (DDAH1) is an enzyme that can degrade asymmetric dimethylarginine (ADMA), an endogenous nitric oxide synthase (NOS)inhibitor (PMID:26996393). About 80% of endogenous ADMA is metabolized by DDAH, principally the DDAH1 isoform (PMID:22460174). It was reported that DDAH1 is highly expressed in vascular endothelial cells in hearts (PMID:19917889). The observed molecular weight of DDAH1 is 35-40 kDa in the literature.