DDHD2 Polyclonal antibody

• 

  WB analysis of rat brain using 25203-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25203-1-AP (DDHD2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 25203-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 25203-1-AP (DDHD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25203-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25203-1-AP (DDHD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 25203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25203-1-AP (DDHD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25203-1-AP (DDHD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 25203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25203-1-AP (DDHD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 25203-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 25203-1-AP (DDHD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 25203-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using DDHD2 antibody (25203-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HEK-293 using 25203-1-AP

  Immunofluorescent analysis of HEK-293 cells using 25203-1-AP (DDHD2 antibody) at dilution of 1:25 and Alexa Fluor 594-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DDHD2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25203-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DDHD domain containing 2, DDHD2, KIAA0725, KIAA0725p, Phospholipase DDHD2, SAMWD1

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse lung tissue, mouse testis tissue
• Positive IHC detected in: mouse brain tissue, mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 6 publications below
• IHC: See 1 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

25203-1-AP targets DDHD2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18373

  Product name: Recombinant human DDHD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 56-174 aa of BC010504

  Sequence: MDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE

• Full Name: DDHD domain containing 2
• Calculated Molecular Weight: 711 aa, 81 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC010504
• Gene Symbol: DDHD2
• Gene ID (NCBI): 23259
• RRID: AB_2879957
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94830
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa (PMID: 11788596).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Protein Cell; Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis; Authors - Xiaoguang Liu
mouse		Neuron; Rewiring Neuronal Glycerolipid Metabolism Determines the Extent of Axon Regeneration.; Authors - Chao Yang ; KD Validated
mouse	WB	J Biol Chem; The phospholipase PNPLA7 functions as a lysophosphatidylcholine hydrolase and interacts with lipid droplets through its catalytic domain.; Authors - Christoph Heier
human	WB,IHC	Cell Death Dis; Circular RNA circRUNX1 promotes papillary thyroid cancer progression and metastasis by sponging MiR-296-3p and regulating DDHD2 expression.; Authors - Junjie Chu ; KD Validated
mouse	WB,IF	J Lipid Res; Cooperative lipolytic control of neuronal triacylglycerol by spastic paraplegia-associated enzyme DDHD2 and ATGL; Authors - Peter Hofer
rat	WB,IF,IP	EMBO J; The DDHD2-STXBP1 interaction mediates long-term memory via generation of saturated free fatty acids; Authors - Isaac O Akefe ; KO Validated