Tested Applications
Positive IF/ICC detected in | HEK-293 cells |
Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-25203 targets DDHD2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18373 Product name: Recombinant human DDHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 56-174 aa of BC010504 Sequence: MDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE Predict reactive species |
Full Name | DDHD domain containing 2 |
Calculated Molecular Weight | 711 aa, 81 kDa |
Observed Molecular Weight | 80-90 kDa |
GenBank Accession Number | BC010504 |
Gene Symbol | DDHD2 |
Gene ID (NCBI) | 23259 |
RRID | AB_3672788 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O94830 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa (PMID: 11788596).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 DDHD2 antibody CL488-25203 | Download protocol |
FC protocol for CL Plus 488 DDHD2 antibody CL488-25203 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |