DDR2 Monoclonal antibody

• 

  WB analysis of Jurkat using 67126-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67126-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67126-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67126-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

DDR2 Monoclonal Antibody for WB, ELISA

Cat No. 67126-1-Ig

Clone No.1E9A10

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IF, ELISA

Synonyms

DDR2, Discoidin domain receptor 2, MIG20a, NTRKR3, TKT, TYRO10, Tyrosine protein kinase TYRO10

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

67126-1-Ig targets DDR2 in WB, IF, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28340

  Product name: Recombinant human DDR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 291-398 aa of NM_001014796

  Sequence: MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT

• Full Name: discoidin domain receptor tyrosine kinase 2
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: NM_001014796
• Gene Symbol: DDR2
• Gene ID (NCBI): 4921
• RRID: AB_2882426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16832
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDR2 (Discoidin domain receptor 2) belongs to the receptor tyrosine kinase (RTK) family and is activated by collagen-binding.DDR2 is implicated in several physiological and pathological processes, including wound healing, angiogenesis, ovulation, spermatogenesis, extracellular matrix (ECM) remodeling and fibrosis, and tumor progression (PMID: 25805889). Moreover, DDR2 is prominently present in the fibroblasts, smooth muscle cells, myofibroblasts, and chondrocytes (PMID: 37834343).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	J Cell Mol Med; The role and mechanism of transforming growth factor beta 3 in human myocardial infarction-induced myocardial fibrosis.; Authors - Ke Xue
human	WB	Int J Biol Macromol; Human type III collagen-derived biomaterial with high antitumor activity inhibits breast cancer cell autophagy, proliferation, and migration through DDR1; Authors - Xiaowei Liu