DDR2 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 67126-1-Ig (same clone as 67126-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67126-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67126-1-Ig (same clone as 67126-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67126-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67126-1-Ig (same clone as 67126-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67126-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67126-1-Ig (same clone as 67126-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67126-1-Ig (DDR2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67126-1-PBS in a different storage buffer formulation.

DDR2 Monoclonal Antibody for WB, ELISA

Cat No. 67126-1-PBS

Clone No.1E9A10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, ELISA

Synonyms

Discoidin domain receptor 2, MIG20a, NTRKR3, TKT, TYRO10

---

Product Information

67126-1-PBS targets DDR2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28340

  Product name: Recombinant human DDR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 291-398 aa of NM_001014796

  Sequence: MFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNT

• Full Name: discoidin domain receptor tyrosine kinase 2
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: NM_001014796
• Gene Symbol: DDR2
• Gene ID (NCBI): 4921
• RRID: AB_2882426
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16832
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.