Product Information
67991-1-PBS targets DDX1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16774 Product name: Recombinant human DDX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 391-740 aa of BC012132 Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 |
| Calculated Molecular Weight | 740 aa, 82 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC012132 |
| Gene Symbol | DDX1 |
| Gene ID (NCBI) | 1653 |
| RRID | AB_2918740 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q92499 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
DDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome.





















