• Featured Product
  • KD/KO Validated

DDX1 Monoclonal antibody, PBS Only

DDX1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67991-1-PBS
Clone No.1G10G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

DEAD box protein retinoblastoma, DEAD box protein 1, DBP-RB, DBP RB, ATP-dependent RNA helicase DDX1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67991-1-PBS targets DDX1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16774

Product name: Recombinant human DDX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 391-740 aa of BC012132

Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
Calculated Molecular Weight 740 aa, 82 kDa
Observed Molecular Weight82 kDa
GenBank Accession NumberBC012132
Gene Symbol DDX1
Gene ID (NCBI) 1653
RRIDAB_2918740
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92499
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome.

Loading...
||
New chat Able
正在加载,请稍候...