DDX49 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 20523-1-AP (same clone as 20523-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20523-1-AP (DDX49 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20523-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20523-1-AP (same clone as 20523-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20523-1-AP (DDX49 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20523-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 20523-1-AP (same clone as 20523-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 20523-1-AP (DDX49 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20523-1-PBS in a different storage buffer formulation.

DDX49 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20523-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DEAD box protein 49, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX49, R27090_2

---

Product Information

20523-1-PBS targets DDX49 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14373

  Product name: Recombinant human DDX49 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 134-313 aa of BC002674

  Sequence: HLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLD

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
• Calculated Molecular Weight: 483 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC002674
• Gene Symbol: DDX49
• Gene ID (NCBI): 54555
• RRID: AB_2878698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6V7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.