DDX49 Polyclonal antibody

• 

  WB analysis of HeLa using 20523-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20523-1-AP (DDX49 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 20523-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 20523-1-AP (DDX49 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

DDX49 Polyclonal Antibody for WB, ELISA

Cat No. 20523-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DDX49, DEAD box protein 49, R27090_2

---

Tested Applications

• Positive WB detected in: HeLa cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20523-1-AP targets DDX49 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14373

  Product name: Recombinant human DDX49 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 134-313 aa of BC002674

  Sequence: HLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLD

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 49
• Calculated Molecular Weight: 483 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC002674
• Gene Symbol: DDX49
• Gene ID (NCBI): 54555
• RRID: AB_2878698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6V7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.