Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26894-1-AP targets DDX54 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 98 kDa |
| GenBank Accession Number | BC156669 |
| Gene Symbol | DDX54 |
| Gene ID (NCBI) | 79039 |
| RRID | AB_2880671 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TDD1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX54 antibody 26894-1-AP | Download protocol |
| IHC protocol for DDX54 antibody 26894-1-AP | Download protocol |
| WB protocol for DDX54 antibody 26894-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDX54 Polyclonal antibody (catalog 26894-1-AP) has 2 citations. It appears in Am J Cancer Res (2024), where it was used in WB and IHC to study how LINC00908 attenuates lung adenocarcinoma tumorigenesis via DDX54—research in oncology/cancer biology. It also appears in bioRxiv (2023), where it was used in WB with RNAi validation to investigate nucleolar dynamics and ordered ribosome assembly. Overall, the citations span cancer research and cell biology, specifically ribosome biogenesis and nucleolar function.
| Species | Application | Title |
|---|---|---|
bioRxiv Nucleolar dynamics are determined by the ordered assembly of the ribosome
|
