DEF6 Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 11369-1-AP (same clone as 11369-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11369-1-AP (DEF6 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11369-1-AP (same clone as 11369-1-PBS)

  WB result of DEF6 antibody (11369-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DEF6 transfected Jurkat cells. This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 11369-1-AP (same clone as 11369-1-PBS)

  IP result of anti-DEF6 (IP:11369-1-AP, 4ug; Detection:11369-1-AP 1:600) with Jurkat cells lysate 2400ug. This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 11369-1-AP (same clone as 11369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11369-1-AP (DEF6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 11369-1-AP (same clone as 11369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11369-1-AP (DEF6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11369-1-AP (same clone as 11369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11369-1-AP (DEF6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11369-1-AP (same clone as 11369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11369-1-AP (DEF6 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 11369-1-AP (same clone as 11369-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 11369-1-AP (DEF6 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11369-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DEF6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11369-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

SLAT, IRF4-binding protein, IRF4 binding protein, IBP, DEF-6

---

Product Information

11369-1-PBS targets DEF6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1925

  Product name: Recombinant human DEF6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-336 aa of BC017504

  Sequence: MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR

• Full Name: differentially expressed in FDCP 6 homolog (mouse)
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC017504
• Gene Symbol: DEF6
• Gene ID (NCBI): 50619
• RRID: AB_2230504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4E7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.