Tested Applications
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18268-1-AP targets DEFA5 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12793 Product name: Recombinant human DEFA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-94 aa of BC069690 Sequence: ERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR Predict reactive species |
| Full Name | defensin, alpha 5, Paneth cell-specific |
| Calculated Molecular Weight | 94 aa, 10 kDa |
| GenBank Accession Number | BC069690 |
| Gene Symbol | DEFA5 |
| Gene ID (NCBI) | 1670 |
| RRID | AB_2878526 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01523 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEFA5, also named as DEF5, belongs to the alpha-defensin family. It has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Mature DEFA5 is about 5kd. It has a homodimer form.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DEFA5 antibody 18268-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



