Tested Applications
Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
18268-1-AP targets DEFA5 in IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12793 Product name: Recombinant human DEFA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-94 aa of BC069690 Sequence: ERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR Predict reactive species |
Full Name | defensin, alpha 5, Paneth cell-specific |
Calculated Molecular Weight | 94 aa, 10 kDa |
GenBank Accession Number | BC069690 |
Gene Symbol | DEFA5 |
Gene ID (NCBI) | 1670 |
RRID | AB_2878526 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01523 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEFA5, also named as DEF5, belongs to the alpha-defensin family. It has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. Mature DEFA5 is about 5kd. It has a homodimer form.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for DEFA5 antibody 18268-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |