Tested Applications
Positive WB detected in | COLO 320 cells, mouse small intestine tissue |
Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 2 publications below |
Product Information
17923-1-AP targets DEFA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12341 Product name: Recombinant human DEFA6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-100 aa of BC093951 Sequence: AEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL Predict reactive species |
Full Name | defensin, alpha 6, Paneth cell-specific |
Calculated Molecular Weight | 100 aa, 11 kDa |
Observed Molecular Weight | 6-10 kDa |
GenBank Accession Number | BC093951 |
Gene Symbol | DEFA6 |
Gene ID (NCBI) | 1671 |
RRID | AB_2878468 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01524 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. DEFA6 is alpha 6 of Defensin. This protein is secret expression and can be cleaved in to the fragments with MW 4-6 kDa. It can be used as a maker of Paneth cell. DEFA6 has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. it may protect cells against infection with HIV-1.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DEFA6 antibody 17923-1-AP | Download protocol |
IHC protocol for DEFA6 antibody 17923-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Clin Invest Human intestinal bitter taste receptors regulate innate immune responses and metabolic regulators in obesity. | ||
Mol Metab Bitter-tasting drugs tune GDF15 and GLP-1 expression via bitter taste or motilin receptors in the intestine of patients with obesity |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Md Zahirul (Verified Customer) (07-23-2025) | For WB, 4hr incubation also showed the same intensity of results as overnight.
|