Tested Applications
| Positive WB detected in | COLO 320 cells, mouse small intestine tissue |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | COLO 320 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17923-1-AP targets DEFA6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12341 Product name: Recombinant human DEFA6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-100 aa of BC093951 Sequence: AEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL Predict reactive species |
| Full Name | defensin, alpha 6, Paneth cell-specific |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC093951 |
| Gene Symbol | DEFA6 |
| Gene ID (NCBI) | 1671 |
| RRID | AB_2878468 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01524 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. DEFA6 is alpha 6 of Defensin. This protein is secret expression and can be cleaved in to the fragments with MW 4-6 kDa. It can be used as a maker of Paneth cell. DEFA6 has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. it may protect cells against infection with HIV-1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DEFA6 antibody 17923-1-AP | Download protocol |
| IHC protocol for DEFA6 antibody 17923-1-AP | Download protocol |
| WB protocol for DEFA6 antibody 17923-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DEFA6 Polyclonal antibody (Cat# 17923-1-AP) has 3 citations published in J Clin Invest, J Transl Med, and Mol Metab. The associated research fields include innate immune regulation in obesity, inflammatory bowel disease biomarker modeling, and gut metabolic signaling via bitter taste receptors.
| Species | Application | Title |
|---|---|---|
J Clin Invest Human intestinal bitter taste receptors regulate innate immune responses and metabolic regulators in obesity. | ||
J Transl Med Construction of a feature gene and machine prediction model for inflammatory bowel disease based on multichip joint analysis | ||
Mol Metab Bitter-tasting drugs tune GDF15 and GLP-1 expression via bitter taste or motilin receptors in the intestine of patients with obesity |
Reviews
What customers say
The single review for 17923-1-AP is a 5-star rating from Md Zahirul Islam Khan (July 2025). The user tested the antibody for Western Blot and Immunohistochemistry on colorectal cancer cells and patient-derived organoids. They used a 1:1000 dilution for WB and 1:250 for IHC. Notably, they observed that a 4-hour WB incubation produced the same signal intensity as an overnight incubation, suggesting strong performance even with shorter protocols.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Md Zahirul (Verified Customer) (07-23-2025) | For WB, 4hr incubation also showed the same intensity of results as overnight.
|
