Tested Applications
| Positive WB detected in | COLO 320 cells, mouse small intestine tissue |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 2 publications below |
Product Information
17923-1-AP targets DEFA6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12341 Product name: Recombinant human DEFA6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-100 aa of BC093951 Sequence: AEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL Predict reactive species |
| Full Name | defensin, alpha 6, Paneth cell-specific |
| Calculated Molecular Weight | 100 aa, 11 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC093951 |
| Gene Symbol | DEFA6 |
| Gene ID (NCBI) | 1671 |
| RRID | AB_2878468 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01524 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. DEFA6 is alpha 6 of Defensin. This protein is secret expression and can be cleaved in to the fragments with MW 4-6 kDa. It can be used as a maker of Paneth cell. DEFA6 has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. it may protect cells against infection with HIV-1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DEFA6 antibody 17923-1-AP | Download protocol |
| WB protocol for DEFA6 antibody 17923-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest Human intestinal bitter taste receptors regulate innate immune responses and metabolic regulators in obesity. | ||
J Transl Med Construction of a feature gene and machine prediction model for inflammatory bowel disease based on multichip joint analysis | ||
Mol Metab Bitter-tasting drugs tune GDF15 and GLP-1 expression via bitter taste or motilin receptors in the intestine of patients with obesity |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Md Zahirul (Verified Customer) (07-23-2025) | For WB, 4hr incubation also showed the same intensity of results as overnight.
|











