DEPP Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 25833-1-AP (same clone as 25833-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25833-1-AP (DEPP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25833-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DEPP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25833-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25833-1-PBS targets DEPP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22773

  Product name: Recombinant human C10orf10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC011402

  Sequence: MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL

• Full Name: chromosome 10 open reading frame 10
• Calculated Molecular Weight: 212 aa, 23 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC011402
• Gene Symbol: DEPP
• Gene ID (NCBI): 11067
• RRID: AB_2880260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NTK1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DEPP, also named as FIG and C10orf10, is known to be differentially regulated in mouse tissues in response to hypoxia and oxidative stress. Moreover, Studies have reported that DEPP1 is one of the early adipogenic markers (PMID:36918557).