Tested Applications
Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
14811-1-AP targets DEXI in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6535 Product name: Recombinant human DEXI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC001083 Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE Predict reactive species |
Full Name | dexamethasone-induced transcript |
Calculated Molecular Weight | 10 kDa |
GenBank Accession Number | BC001083 |
Gene Symbol | DEXI |
Gene ID (NCBI) | 28955 |
RRID | AB_2092618 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95424 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEXI, also named as MYLE, is a potential marker for glucocorticoid responsiveness in treated patients and may play a role in modulating the function of inflammatory proteins. It is a 95 residues acidic protein.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for DEXI antibody 14811-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Stephen (Verified Customer) (09-10-2019) | Good Dexi antibody. Showed up our positive control cell line really well at a good solution (1:2000)
|