DHRS9 Polyclonal antibody, PBS Only

• 

  WB analysis using 14560-1-AP (same clone as 14560-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14560-1-AP (same clone as 14560-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse trachea using 14560-1-AP (same clone as 14560-1-PBS)

  mouse trachea tissue were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14560-1-AP (same clone as 14560-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14560-1-AP (same clone as 14560-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 14560-1-AP (same clone as 14560-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using DHRS9 antibody (14560-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 14560-1-AP (same clone as 14560-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using 14560-1-AP (DHRS9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14560-1-PBS in a different storage buffer formulation.

DHRS9 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14560-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14560-1-PBS targets DHRS9 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6116

  Product name: Recombinant human DHRS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-319 aa of BC058883

  Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

• Full Name: dehydrogenase/reductase (SDR family) member 9
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC058883
• Gene Symbol: DHRS9
• Gene ID (NCBI): 10170
• RRID: AB_2277277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPW9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Dehydrogenase/reductase 9(DHRS9), is a member of the short-chain dehydrogenases/reductases (SDR) family. DHRS9 has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. DHRS9 has 4 isoforms with molecular weight of 19, 30, 35, 42 kDa, and demonstrates oxidoreductase activity toward hydroxysteroids. DHRS9 is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus.