DHRS9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DHRS9 Polyclonal antibody (14560-1-AP)

DHRS9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14560-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.1.1.209, EC:1.1.1.105, 3-alpha-HSD, 3-alpha hydroxysteroid dehydrogenase, 3ALPHA HSD

• 

  WB analysis using 14560-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14560-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse trachea using 14560-1-AP

  mouse trachea tissue were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14560-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14560-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 14560-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using DHRS9 antibody (14560-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 14560-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using 14560-1-AP (DHRS9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DHRS9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse trachea tissue, HT-29 cells, THP-1 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14560-1-AP targets DHRS9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6116

  Product name: Recombinant human DHRS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-319 aa of BC058883

  Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

• Full Name: dehydrogenase/reductase (SDR family) member 9
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC058883
• Gene Symbol: DHRS9
• Gene ID (NCBI): 10170
• RRID: AB_2277277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPW9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dehydrogenase/reductase 9(DHRS9), is a member of the short-chain dehydrogenases/reductases (SDR) family. DHRS9 has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. DHRS9 has 4 isoforms with molecular weight of 19, 30, 35, 42 kDa, and demonstrates oxidoreductase activity toward hydroxysteroids. DHRS9 is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus.

Publications

What published studies show

The DHRS9 Polyclonal antibody (catalog number 14560-1-AP) has 4 total citations. These appear in EPMA Journal, Molecular Oncology, Frontiers in Molecular Biosciences, and European Journal of Psychotraumatology. The associated research fields include atherosclerosis (predictive and personalized medicine), colorectal carcinoma brain metastases, chronic obstructive pulmonary disease (emphysematous phenotype), and major depressive disorder (immune-related biomarkers). Applications span WB, IF, and IHC across human, mouse, and rat samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IF,WB	EPMA J; Identifying potential signatures for atherosclerosis in the context of predictive, preventive, and personalized medicine using integrative bioinformatics approaches and machine-learning strategies; Authors - Jinling Xu
human	IHC	Mol Oncol; Consensus molecular subtyping of colorectal carcinoma brain metastases reveals a metabolic signature associated with poor patient survival; Authors - Barnabas Irmer
human	WB	Front Mol Biosci; Identification of Proteomic Signatures in Chronic Obstructive Pulmonary Disease Emphysematous Phenotype.; Authors - Shuang Bai
rat	IHC	Eur J Psychotraumatol; Immune-related biomarkers for major depressive disorder identified via integrated bioinformatics and machine learning.; Authors - Yu Zhang