DHRS9 Polyclonal antibody

• 

  WB analysis using 14560-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse trachea using 14560-1-AP

  mouse trachea tissue were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14560-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14560-1-AP (DHRS9 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 14560-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 14560-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14560-1-AP (DHRS9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 14560-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using DHRS9 antibody (14560-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A549 using 14560-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using 14560-1-AP (DHRS9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

DHRS9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14560-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:1.1.1.209, EC:1.1.1.105, 3-alpha-HSD, 3-alpha hydroxysteroid dehydrogenase, 3ALPHA HSD

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse trachea tissue, HT-29 cells, THP-1 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

14560-1-AP targets DHRS9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6116

  Product name: Recombinant human DHRS9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-319 aa of BC058883

  Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

• Full Name: dehydrogenase/reductase (SDR family) member 9
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC058883
• Gene Symbol: DHRS9
• Gene ID (NCBI): 10170
• RRID: AB_2277277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPW9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Dehydrogenase/reductase 9(DHRS9), is a member of the short-chain dehydrogenases/reductases (SDR) family. DHRS9 has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. DHRS9 has 4 isoforms with molecular weight of 19, 30, 35, 42 kDa, and demonstrates oxidoreductase activity toward hydroxysteroids. DHRS9 is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Mol Biosci; Identification of Proteomic Signatures in Chronic Obstructive Pulmonary Disease Emphysematous Phenotype.; Authors - Shuang Bai
human,mouse	IF,WB	EPMA J; Identifying potential signatures for atherosclerosis in the context of predictive, preventive, and personalized medicine using integrative bioinformatics approaches and machine-learning strategies; Authors - Jinling Xu
human	IHC	Mol Oncol; Consensus molecular subtyping of colorectal carcinoma brain metastases reveals a metabolic signature associated with poor patient survival; Authors - Barnabas Irmer