• Featured Product
  • KD/KO Validated

DHX9 Monoclonal antibody, PBS Only (Detector)

DHX9 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Cytometric bead array, Indirect ELISA

Cat No. 67153-1-PBS
Clone No.1B12C10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Cytometric bead array, Indirect ELISA

1B12C10, ATP-dependent RNA helicase A, DDX9, DExH-box helicase 9, EC:3.6.4.13

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67153-1-PBS targets DHX9 as part of a matched antibody pair:

MP50161-1: 67153-2-PBS capture and 67153-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12104

Product name: Recombinant human DHX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC014246

Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP

Predict reactive species
Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 9
Calculated Molecular Weight 1270 aa, 141 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC014246
Gene Symbol DHX9
Gene ID (NCBI) 1660
RRIDAB_2882450
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ08211
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].

Loading...
||
New chat

Able

正在加载,请稍候...